Anti-SPPL2A

Catalog Number: ATA-HPA036062
Article Name: Anti-SPPL2A
Biozol Catalog Number: ATA-HPA036062
Supplier Catalog Number: HPA036062
Alternative Catalog Number: ATA-HPA036062-100,ATA-HPA036062-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IMP3, PSL2
signal peptide peptidase like 2A
Anti-SPPL2A
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 84888
UniProt: Q8TCT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SPPL2A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human parathyroid gland and cerebral cortex tissues using HPA036062 antibody. Corresponding SPPL2A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemical staining of human parathyroid gland shows moderate positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows weak positivity.
HPA036062-100ul
HPA036062-100ul
HPA036062-100ul