Anti-SPPL2A Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA036062
- Images (8)
| Article Name: | Anti-SPPL2A Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA036062 |
| Supplier Catalog Number: | HPA036062 |
| Alternative Catalog Number: | ATA-HPA036062-100,ATA-HPA036062-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IMP3, PSL2 |
| signal peptide peptidase like 2A |
| Anti-SPPL2A |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 84888 |
| UniProt: | Q8TCT8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SPPL2A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human parathyroid gland and cerebral cortex tissues using HPA036062 antibody. Corresponding SPPL2A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human parathyroid gland shows moderate positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak positivity. |
|
|
HPA036062 |
|
|
HPA036062 |
|
|
HPA036062 |
Product Guarantee and Expert Support
