Anti-FGF19
Artikelnummer:
ATA-HPA036082
- Bilder (7)
| Artikelname: | Anti-FGF19 |
| Artikelnummer: | ATA-HPA036082 |
| Hersteller Artikelnummer: | HPA036082 |
| Alternativnummer: | ATA-HPA036082-100,ATA-HPA036082-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FGF19 |
| fibroblast growth factor 19 |
| Anti-FGF19 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9965 |
| UniProt: | O95750 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FGF19 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human gallbladder shows strong granular positivity in cytoplasm in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human placenta shows strong positivity in plasma. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells. |
|
|
HPA036082-100ul |
|
|
HPA036082-100ul |
|
|
HPA036082-100ul |
Produktgarantie und fachkundiger Support
