Anti-FGF19
Catalog Number:
ATA-HPA036082
- Images (7)
| Article Name: | Anti-FGF19 |
| Biozol Catalog Number: | ATA-HPA036082 |
| Supplier Catalog Number: | HPA036082 |
| Alternative Catalog Number: | ATA-HPA036082-100,ATA-HPA036082-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FGF19 |
| fibroblast growth factor 19 |
| Anti-FGF19 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 9965 |
| UniProt: | O95750 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FGF19 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human gallbladder shows strong granular positivity in cytoplasm in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human placenta shows strong positivity in plasma. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells. |
|
|
HPA036082-100ul |
|
|
HPA036082-100ul |
|
|
HPA036082-100ul |
Product Guarantee and Expert Support
