Anti-PRR27

Artikelnummer: ATA-HPA036150
Artikelname: Anti-PRR27
Artikelnummer: ATA-HPA036150
Hersteller Artikelnummer: HPA036150
Alternativnummer: ATA-HPA036150-100,ATA-HPA036150-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C4orf40
proline rich 27
Anti-PRR27
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 401137
UniProt: Q6MZM9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RRFPFIGEDDNDDGHPLHPSLNIPYGIRNLPPPLYYRPVNTVPSYPGNTYTDTGLPSYPWILTSPGFPYVYHIRGFPLATQLNVPPLP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PRR27
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human salivary gland and colon tissues using Anti-PRR27 antibody. Corresponding PRR27 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, lymph node, salivary gland and testis using Anti-PRR27 antibody HPA036150 (A) shows similar protein distribution across tissues to independent antibody HPA036151 (B).
Immunohistochemical staining of human salivary gland shows high expression.
Immunohistochemical staining of human colon shows low expression as expected.
Immunohistochemical staining of human testis using Anti-PRR27 antibody HPA036150.
Immunohistochemical staining of human lymph node using Anti-PRR27 antibody HPA036150.
HPA036150-100ul
HPA036150-100ul
HPA036150-100ul