Anti-PRR27
Catalog Number:
ATA-HPA036150
- Images (9)
| Article Name: | Anti-PRR27 |
| Biozol Catalog Number: | ATA-HPA036150 |
| Supplier Catalog Number: | HPA036150 |
| Alternative Catalog Number: | ATA-HPA036150-100,ATA-HPA036150-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C4orf40 |
| proline rich 27 |
| Anti-PRR27 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 401137 |
| UniProt: | Q6MZM9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RRFPFIGEDDNDDGHPLHPSLNIPYGIRNLPPPLYYRPVNTVPSYPGNTYTDTGLPSYPWILTSPGFPYVYHIRGFPLATQLNVPPLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRR27 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human salivary gland and colon tissues using Anti-PRR27 antibody. Corresponding PRR27 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, lymph node, salivary gland and testis using Anti-PRR27 antibody HPA036150 (A) shows similar protein distribution across tissues to independent antibody HPA036151 (B). |
|
|
Immunohistochemical staining of human salivary gland shows high expression. |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-PRR27 antibody HPA036150. |
|
|
Immunohistochemical staining of human lymph node using Anti-PRR27 antibody HPA036150. |
|
|
HPA036150-100ul |
|
|
HPA036150-100ul |
|
|
HPA036150-100ul |
Product Guarantee and Expert Support
