Anti-SLC7A7

Artikelnummer: ATA-HPA036227
Artikelname: Anti-SLC7A7
Artikelnummer: ATA-HPA036227
Hersteller Artikelnummer: HPA036227
Alternativnummer: ATA-HPA036227-100,ATA-HPA036227-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: LPI, y+LAT-1
solute carrier family 7 (amino acid transporter light chain, y+L system), member 7
Anti-SLC7A7
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 9056
UniProt: Q9UM01
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC7A7
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human kidney and prostate tissues using Anti-SLC7A7 antibody. Corresponding SLC7A7 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and SLC7A7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418308).
HPA036227-100ul
HPA036227-100ul
HPA036227-100ul