Anti-SLC7A7

Catalog Number: ATA-HPA036227
Article Name: Anti-SLC7A7
Biozol Catalog Number: ATA-HPA036227
Supplier Catalog Number: HPA036227
Alternative Catalog Number: ATA-HPA036227-100,ATA-HPA036227-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LPI, y+LAT-1
solute carrier family 7 (amino acid transporter light chain, y+L system), member 7
Anti-SLC7A7
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 9056
UniProt: Q9UM01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLC7A7
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human kidney and prostate tissues using Anti-SLC7A7 antibody. Corresponding SLC7A7 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and SLC7A7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418308).
HPA036227-100ul
HPA036227-100ul
HPA036227-100ul