Anti-SELENOP Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA036287
Artikelname: Anti-SELENOP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA036287
Hersteller Artikelnummer: HPA036287
Alternativnummer: ATA-HPA036287-100,ATA-HPA036287-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SELP, SeP, SEPP, SEPP1
selenoprotein P
Anti-SELENOP
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 6414
UniProt: P49908
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SELENOP
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & the Golgi apparatus.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
HPA036287
HPA036287
HPA036287