Anti-SELENOP Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SELENOP Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA036287
• Supplier Catalog Number: HPA036287
• Alternative Catalog Number: ATA-HPA036287-100,ATA-HPA036287-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: SELP, SeP, SEPP, SEPP1

Product Description

selenoprotein P

Additional Information

Anti-SELENOP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 6414
• UniProt: P49908
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SELENOP
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & the Golgi apparatus.

Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

HPA036287

HPA036287

HPA036287