Anti-GNL3L
Artikelnummer:
ATA-HPA036314
- Bilder (7)
| Artikelname: | Anti-GNL3L |
| Artikelnummer: | ATA-HPA036314 |
| Hersteller Artikelnummer: | HPA036314 |
| Alternativnummer: | ATA-HPA036314-100,ATA-HPA036314-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10613 |
| guanine nucleotide binding protein-like 3 (nucleolar)-like |
| Anti-GNL3L |
| Klonalität: | Polyclonal |
| Konzentration: | 1.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54552 |
| UniProt: | Q9NVN8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GNL3L |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells. |
|
|
Western blot analysis using Anti-GNL3L antibody HPA036314 (A) shows similar pattern to independent antibody HPA036315 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA036314-100ul |
|
|
|
|
|
HPA036314-100ul |
|
|
HPA036314-100ul |
Produktgarantie und fachkundiger Support
