Anti-GNL3L
Catalog Number:
ATA-HPA036314
- Images (7)
| Article Name: | Anti-GNL3L |
| Biozol Catalog Number: | ATA-HPA036314 |
| Supplier Catalog Number: | HPA036314 |
| Alternative Catalog Number: | ATA-HPA036314-100,ATA-HPA036314-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ10613 |
| guanine nucleotide binding protein-like 3 (nucleolar)-like |
| Anti-GNL3L |
| Clonality: | Polyclonal |
| Concentration: | 1.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 54552 |
| UniProt: | Q9NVN8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GNL3L |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells. |
|
|
Western blot analysis using Anti-GNL3L antibody HPA036314 (A) shows similar pattern to independent antibody HPA036315 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA036314-100ul |
|
|
|
|
|
HPA036314-100ul |
|
|
HPA036314-100ul |
Product Guarantee and Expert Support
