Anti-SH3PXD2B
Artikelnummer:
ATA-HPA036471
- Bilder (8)
| Artikelname: | Anti-SH3PXD2B |
| Artikelnummer: | ATA-HPA036471 |
| Hersteller Artikelnummer: | HPA036471 |
| Alternativnummer: | ATA-HPA036471-100,ATA-HPA036471-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20831, KIAA1295 |
| SH3 and PX domains 2B |
| Anti-SH3PXD2B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 285590 |
| UniProt: | A1X283 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SH3PXD2B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & plasma membrane. |
|
|
Immunohistochemical staining of human soft tissue shows moderate cytoplasmic positivity in fibroblasts. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SH3PXD2B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
HPA036471 |
|
|
|
|
|
|
|
|
HPA036471 |
|
|
HPA036471 |
Produktgarantie und fachkundiger Support
