Anti-SH3PXD2B

Catalog Number: ATA-HPA036471
Article Name: Anti-SH3PXD2B
Biozol Catalog Number: ATA-HPA036471
Supplier Catalog Number: HPA036471
Alternative Catalog Number: ATA-HPA036471-100,ATA-HPA036471-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ20831, KIAA1295
SH3 and PX domains 2B
Anti-SH3PXD2B
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 285590
UniProt: A1X283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SH3PXD2B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & plasma membrane.
Immunohistochemical staining of human soft tissue shows moderate cytoplasmic positivity in fibroblasts.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SH3PXD2B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
HPA036471-100ul
HPA036471-100ul
HPA036471-100ul