Anti-HOMER1
Artikelnummer:
ATA-HPA036521
- Bilder (9)
| Artikelname: | Anti-HOMER1 |
| Artikelnummer: | ATA-HPA036521 |
| Hersteller Artikelnummer: | HPA036521 |
| Alternativnummer: | ATA-HPA036521-100,ATA-HPA036521-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HOMER-1B, SYN47, Ves-1 |
| homer homolog 1 (Drosophila) |
| Anti-HOMER1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9456 |
| UniProt: | Q86YM7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HOMER1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-HOMER1 antibody. Corresponding HOMER1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, heart muscle and pancreas using Anti-HOMER1 antibody HPA036521 (A) shows similar protein distribution across tissues to independent antibody HPA036522 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human heart muscle using Anti-HOMER1 antibody HPA036521. |
|
|
Immunohistochemical staining of human colon using Anti-HOMER1 antibody HPA036521. |
|
|
HPA036521-100ul |
|
|
HPA036521-100ul |
|
|
HPA036521-100ul |
Produktgarantie und fachkundiger Support
