Anti-HOMER1
Catalog Number:
ATA-HPA036521
- Images (9)
| Article Name: | Anti-HOMER1 |
| Biozol Catalog Number: | ATA-HPA036521 |
| Supplier Catalog Number: | HPA036521 |
| Alternative Catalog Number: | ATA-HPA036521-100,ATA-HPA036521-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HOMER-1B, SYN47, Ves-1 |
| homer homolog 1 (Drosophila) |
| Anti-HOMER1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 9456 |
| UniProt: | Q86YM7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HOMER1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-HOMER1 antibody. Corresponding HOMER1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, heart muscle and pancreas using Anti-HOMER1 antibody HPA036521 (A) shows similar protein distribution across tissues to independent antibody HPA036522 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human heart muscle using Anti-HOMER1 antibody HPA036521. |
|
|
Immunohistochemical staining of human colon using Anti-HOMER1 antibody HPA036521. |
|
|
HPA036521-100ul |
|
|
HPA036521-100ul |
|
|
HPA036521-100ul |
Product Guarantee and Expert Support
