Anti-SCFD2
Artikelnummer:
ATA-HPA036527
- Bilder (8)
| Artikelname: | Anti-SCFD2 |
| Artikelnummer: | ATA-HPA036527 |
| Hersteller Artikelnummer: | HPA036527 |
| Alternativnummer: | ATA-HPA036527-100,ATA-HPA036527-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ39514, STXBP1L1 |
| sec1 family domain containing 2 |
| Anti-SCFD2 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 152579 |
| UniProt: | Q8WU76 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ALAQVFCEESGLSPLLQKITDWDSSINLTFHKSKIAVDELFTSLRDIAGARSLLKQFKSVYVPGNHTHQASYKPLLKQVVEEIFHPERPDSVDIEH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SCFD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, cervix, uterine, kidney and testis using Anti-SCFD2 antibody HPA036527 (A) shows similar protein distribution across tissues to independent antibody HPA036526 (B). |
|
|
Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human cervix, uterine shows weak cytoplasmic positivity in squamous epithelial cells. |
|
|
HPA036527 |
|
|
HPA036527 |
|
|
HPA036527 |
Produktgarantie und fachkundiger Support
