Anti-SCFD2
Catalog Number:
ATA-HPA036527
- Images (8)
| Article Name: | Anti-SCFD2 |
| Biozol Catalog Number: | ATA-HPA036527 |
| Supplier Catalog Number: | HPA036527 |
| Alternative Catalog Number: | ATA-HPA036527-100,ATA-HPA036527-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ39514, STXBP1L1 |
| sec1 family domain containing 2 |
| Anti-SCFD2 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 152579 |
| UniProt: | Q8WU76 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ALAQVFCEESGLSPLLQKITDWDSSINLTFHKSKIAVDELFTSLRDIAGARSLLKQFKSVYVPGNHTHQASYKPLLKQVVEEIFHPERPDSVDIEH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SCFD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, cervix, uterine, kidney and testis using Anti-SCFD2 antibody HPA036527 (A) shows similar protein distribution across tissues to independent antibody HPA036526 (B). |
|
|
Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human cervix, uterine shows weak cytoplasmic positivity in squamous epithelial cells. |
|
|
HPA036527-100ul |
|
|
HPA036527-100ul |
|
|
HPA036527-100ul |
Product Guarantee and Expert Support
