Anti-TRMT10C

Artikelnummer: ATA-HPA036671
Artikelname: Anti-TRMT10C
Artikelnummer: ATA-HPA036671
Hersteller Artikelnummer: HPA036671
Alternativnummer: ATA-HPA036671-100,ATA-HPA036671-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ20432, MRPP1, RG9MTD1
tRNA methyltransferase 10 homolog C (S. cerevisiae)
Anti-TRMT10C
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 54931
UniProt: Q7L0Y3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRMT10C
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRMT10C antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in human cell line SCLC-21H.
HPA036671-100ul
HPA036671-100ul
HPA036671-100ul