Anti-TRMT10C
Artikelnummer:
ATA-HPA036671
- Bilder (7)
| Artikelname: | Anti-TRMT10C |
| Artikelnummer: | ATA-HPA036671 |
| Hersteller Artikelnummer: | HPA036671 |
| Alternativnummer: | ATA-HPA036671-100,ATA-HPA036671-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20432, MRPP1, RG9MTD1 |
| tRNA methyltransferase 10 homolog C (S. cerevisiae) |
| Anti-TRMT10C |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54931 |
| UniProt: | Q7L0Y3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TRMT10C |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria. |
|
|
Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRMT10C antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in human cell line SCLC-21H. |
|
|
HPA036671-100ul |
|
|
HPA036671-100ul |
|
|
HPA036671-100ul |
Produktgarantie und fachkundiger Support
