Anti-TRMT10C
Catalog Number:
ATA-HPA036671
- Images (7)
| Article Name: | Anti-TRMT10C |
| Biozol Catalog Number: | ATA-HPA036671 |
| Supplier Catalog Number: | HPA036671 |
| Alternative Catalog Number: | ATA-HPA036671-100,ATA-HPA036671-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ20432, MRPP1, RG9MTD1 |
| tRNA methyltransferase 10 homolog C (S. cerevisiae) |
| Anti-TRMT10C |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 54931 |
| UniProt: | Q7L0Y3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TRMT10C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria. |
|
|
Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRMT10C antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in human cell line SCLC-21H. |
|
|
HPA036671-100ul |
|
|
HPA036671-100ul |
|
|
HPA036671-100ul |
Product Guarantee and Expert Support
