Anti-CD34

Artikelnummer: ATA-HPA036722
Artikelname: Anti-CD34
Artikelnummer: ATA-HPA036722
Hersteller Artikelnummer: HPA036722
Alternativnummer: ATA-HPA036722-100,ATA-HPA036722-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
CD34 molecule
Anti-CD34
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 947
UniProt: P28906
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD34
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human placenta and tonsil tissues using HPA036722 antibody. Corresponding CD34 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemical staining of human tonsil shows moderate to strong membranous positivity in endothelial cells.
Western blot analysis in human cell line MOLT-4.
HPA036722-100ul
HPA036722-100ul
HPA036722-100ul