Anti-CD34

Catalog Number: ATA-HPA036722
Article Name: Anti-CD34
Biozol Catalog Number: ATA-HPA036722
Supplier Catalog Number: HPA036722
Alternative Catalog Number: ATA-HPA036722-100,ATA-HPA036722-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
CD34 molecule
Anti-CD34
Clonality: Polyclonal
Isotype: IgG
NCBI: 947
UniProt: P28906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CD34
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human placenta and tonsil tissues using HPA036722 antibody. Corresponding CD34 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemical staining of human tonsil shows moderate to strong membranous positivity in endothelial cells.
Western blot analysis in human cell line MOLT-4.
HPA036722-100ul
HPA036722-100ul
HPA036722-100ul