Anti-GCG

Artikelnummer: ATA-HPA036761
Artikelname: Anti-GCG
Artikelnummer: ATA-HPA036761
Hersteller Artikelnummer: HPA036761
Alternativnummer: ATA-HPA036761-100,ATA-HPA036761-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GLP1, GLP2, GRPP
glucagon
Anti-GCG
Klonalität: Polyclonal
Konzentration: 0.6 mg/ml
Isotyp: IgG
NCBI: 2641
UniProt: P01275
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GCG
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human pancreas and skeletal muscle tissues using HPA036761 antibody. Corresponding GCG RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, pancreas, skeletal muscle and small intestine using Anti-GCG antibody HPA036761 (A) shows similar protein distribution across tissues to independent antibody HPA036760 (B).
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in endocrine glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.
HPA036761-100ul
HPA036761-100ul
HPA036761-100ul