Anti-GCG

Product Overview

• Article Name: Anti-GCG
• Biozol Catalog Number: ATA-HPA036761
• Supplier Catalog Number: HPA036761
• Alternative Catalog Number: ATA-HPA036761-100,ATA-HPA036761-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GLP1, GLP2, GRPP

Product Description

glucagon

Additional Information

Anti-GCG

Product Properties

• Clonality: Polyclonal
• Concentration: 0.6 mg/ml
• Isotype: IgG
• NCBI: 2641
• UniProt: P01275
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GCG
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human pancreas and skeletal muscle tissues using HPA036761 antibody. Corresponding GCG RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human colon, pancreas, skeletal muscle and small intestine using Anti-GCG antibody HPA036761 (A) shows similar protein distribution across tissues to independent antibody HPA036760 (B).

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in endocrine glandular cells.

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.

HPA036761-100ul

HPA036761-100ul

HPA036761-100ul