Anti-TRIP12

Artikelnummer: ATA-HPA036835
Artikelname: Anti-TRIP12
Artikelnummer: ATA-HPA036835
Hersteller Artikelnummer: HPA036835
Alternativnummer: ATA-HPA036835-100,ATA-HPA036835-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0045
thyroid hormone receptor interactor 12
Anti-TRIP12
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 9320
UniProt: Q14669
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRIP12
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-TRIP12 antibody. Corresponding TRIP12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
HPA036835-100ul
HPA036835-100ul
HPA036835-100ul