Anti-TRIP12
Catalog Number:
ATA-HPA036835
- Images (8)
| Article Name: | Anti-TRIP12 |
| Biozol Catalog Number: | ATA-HPA036835 |
| Supplier Catalog Number: | HPA036835 |
| Alternative Catalog Number: | ATA-HPA036835-100,ATA-HPA036835-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0045 |
| thyroid hormone receptor interactor 12 |
| Anti-TRIP12 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9320 |
| UniProt: | Q14669 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TRIP12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles. |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-TRIP12 antibody. Corresponding TRIP12 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
|
|
|
HPA036835 |
|
|
HPA036835 |
|
|
HPA036835 |
Product Guarantee and Expert Support
