Anti-TRNT1

Artikelnummer: ATA-HPA036938
Artikelname: Anti-TRNT1
Artikelnummer: ATA-HPA036938
Hersteller Artikelnummer: HPA036938
Alternativnummer: ATA-HPA036938-100,ATA-HPA036938-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CCA1, CGI-47, MtCCA
tRNA nucleotidyl transferase, CCA-adding, 1
Anti-TRNT1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 51095
UniProt: Q96Q11
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRNT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
Immunohistochemical staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in human cell line A-549.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA036938-100ul
HPA036938-100ul
HPA036938-100ul