Anti-TRNT1

Catalog Number: ATA-HPA036938
Article Name: Anti-TRNT1
Biozol Catalog Number: ATA-HPA036938
Supplier Catalog Number: HPA036938
Alternative Catalog Number: ATA-HPA036938-100,ATA-HPA036938-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CCA1, CGI-47, MtCCA
tRNA nucleotidyl transferase, CCA-adding, 1
Anti-TRNT1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 51095
UniProt: Q96Q11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TRNT1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
Immunohistochemical staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in human cell line A-549.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA036938-100ul
HPA036938-100ul
HPA036938-100ul