Anti-BANK1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA037002
Artikelname: Anti-BANK1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA037002
Hersteller Artikelnummer: HPA037002
Alternativnummer: ATA-HPA037002-100,ATA-HPA037002-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BANK, FLJ20706
B-cell scaffold protein with ankyrin repeats 1
Anti-BANK1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 55024
UniProt: Q8NDB2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BANK1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using HPA037002 antibody. Corresponding BANK1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.
HPA037002
HPA037002
HPA037002