Anti-BANK1
Catalog Number:
ATA-HPA037002
- Images (8)
| Article Name: | Anti-BANK1 |
| Biozol Catalog Number: | ATA-HPA037002 |
| Supplier Catalog Number: | HPA037002 |
| Alternative Catalog Number: | ATA-HPA037002-100,ATA-HPA037002-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BANK, FLJ20706 |
| B-cell scaffold protein with ankyrin repeats 1 |
| Anti-BANK1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 55024 |
| UniProt: | Q8NDB2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BANK1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using HPA037002 antibody. Corresponding BANK1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells. |
|
|
Immunohistochemical staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells. |
|
|
HPA037002-100ul |
|
|
HPA037002-100ul |
|
|
HPA037002-100ul |
Product Guarantee and Expert Support
