Anti-SLC1A3

Artikelnummer: ATA-HPA037468
Artikelname: Anti-SLC1A3
Artikelnummer: ATA-HPA037468
Hersteller Artikelnummer: HPA037468
Alternativnummer: ATA-HPA037468-100,ATA-HPA037468-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EA6, EAAT1, GLAST
solute carrier family 1 (glial high affinity glutamate transporter), member 3
Anti-SLC1A3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 6507
UniProt: P43003
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC1A3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA037468 antibody. Corresponding SLC1A3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, liver, lymph node and pancreas using Anti-SLC1A3 antibody HPA037468 (A) shows similar protein distribution across tissues to independent antibody HPA037467 (B).
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemical staining of human liver shows very weak positivity in hepatocytes.
Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells.
HPA037468-100ul
HPA037468-100ul
HPA037468-100ul