Anti-SLC1A3

Product Overview

• Article Name: Anti-SLC1A3
• Biozol Catalog Number: ATA-HPA037468
• Supplier Catalog Number: HPA037468
• Alternative Catalog Number: ATA-HPA037468-100,ATA-HPA037468-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: EA6, EAAT1, GLAST

Product Description

solute carrier family 1 (glial high affinity glutamate transporter), member 3

Additional Information

Anti-SLC1A3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 6507
• UniProt: P43003
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SLC1A3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500

Images

Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA037468 antibody. Corresponding SLC1A3 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, liver, lymph node and pancreas using Anti-SLC1A3 antibody HPA037468 (A) shows similar protein distribution across tissues to independent antibody HPA037467 (B).

Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells.

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.

Immunohistochemical staining of human liver shows very weak positivity in hepatocytes.

Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells.

HPA037468-100ul

HPA037468-100ul

HPA037468-100ul