Anti-DNAH5

Artikelnummer: ATA-HPA037470
Artikelname: Anti-DNAH5
Artikelnummer: ATA-HPA037470
Hersteller Artikelnummer: HPA037470
Alternativnummer: ATA-HPA037470-100,ATA-HPA037470-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CILD3, Dnahc5, HL1, KTGNR, PCD
dynein, axonemal, heavy chain 5
Anti-DNAH5
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1767
UniProt: Q8TE73
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAH5
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-DNAH5 antibody. Corresponding DNAH5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, fallopian tube, lymph node and nasopharynx using Anti-DNAH5 antibody HPA037470 (A) shows similar protein distribution across tissues to independent antibody HPA037469 (B).
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human cerebral cortex using Anti-DNAH5 antibody HPA037470.
Immunohistochemical staining of human lymph node using Anti-DNAH5 antibody HPA037470.
Immunohistochemical staining of human nasopharynx using Anti-DNAH5 antibody HPA037470.
HPA037470-100ul
HPA037470-100ul
HPA037470-100ul