Anti-DNAH5

Product Overview

• Article Name: Anti-DNAH5
• Biozol Catalog Number: ATA-HPA037470
• Supplier Catalog Number: HPA037470
• Alternative Catalog Number: ATA-HPA037470-100,ATA-HPA037470-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Molekularbiologie
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CILD3, Dnahc5, HL1, KTGNR, PCD

Product Description

dynein, axonemal, heavy chain 5

Additional Information

Anti-DNAH5

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1767
• UniProt: Q8TE73
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DNAH5
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-DNAH5 antibody. Corresponding DNAH5 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, fallopian tube, lymph node and nasopharynx using Anti-DNAH5 antibody HPA037470 (A) shows similar protein distribution across tissues to independent antibody HPA037469 (B).

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human fallopian tube shows high expression.

Immunohistochemical staining of human cerebral cortex using Anti-DNAH5 antibody HPA037470.

Immunohistochemical staining of human lymph node using Anti-DNAH5 antibody HPA037470.

Immunohistochemical staining of human nasopharynx using Anti-DNAH5 antibody HPA037470.

HPA037470-100ul

HPA037470-100ul

HPA037470-100ul