Anti-POLR2B
Artikelnummer:
ATA-HPA037506
- Bilder (7)
| Artikelname: | Anti-POLR2B |
| Artikelnummer: | ATA-HPA037506 |
| Hersteller Artikelnummer: | HPA037506 |
| Alternativnummer: | ATA-HPA037506-100,ATA-HPA037506-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RPB2 |
| polymerase (RNA) II (DNA directed) polypeptide B, 140kDa |
| Anti-POLR2B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5431 |
| UniProt: | P30876 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | POLR2B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
|
|
|
HPA037506-100ul |
|
|
HPA037506-100ul |
|
|
HPA037506-100ul |
Produktgarantie und fachkundiger Support
