Anti-POLR2B
Catalog Number:
ATA-HPA037506
- Images (7)
| Article Name: | Anti-POLR2B |
| Biozol Catalog Number: | ATA-HPA037506 |
| Supplier Catalog Number: | HPA037506 |
| Alternative Catalog Number: | ATA-HPA037506-100,ATA-HPA037506-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RPB2 |
| polymerase (RNA) II (DNA directed) polypeptide B, 140kDa |
| Anti-POLR2B |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5431 |
| UniProt: | P30876 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | POLR2B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
|
|
|
HPA037506-100ul |
|
|
HPA037506-100ul |
|
|
HPA037506-100ul |
Product Guarantee and Expert Support
