Anti-MMADHC
Artikelnummer:
ATA-HPA037532
- Bilder (9)
| Artikelname: | Anti-MMADHC |
| Artikelnummer: | ATA-HPA037532 |
| Hersteller Artikelnummer: | HPA037532 |
| Alternativnummer: | ATA-HPA037532-100,ATA-HPA037532-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C2orf25, cblD, CL25022 |
| methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria |
| Anti-MMADHC |
| Klonalität: | Polyclonal |
| Konzentration: | 1.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 27249 |
| UniProt: | Q9H3L0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TLPDVLAEPLSSERHEFVMAQYVNEFQGNDAPVEQEINSAETYFESARVECAIQTCPELLRKDFESLFPEVANGKLMILTVTQKTKNDMTVWSEEV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MMADHC |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in human cell line K562. |
|
|
HPA037532-100ul |
|
|
|
|
|
HPA037532-100ul |
|
|
HPA037532-100ul |
Produktgarantie und fachkundiger Support
