Anti-MMADHC
Catalog Number:
ATA-HPA037532
- Images (9)
| Article Name: | Anti-MMADHC |
| Biozol Catalog Number: | ATA-HPA037532 |
| Supplier Catalog Number: | HPA037532 |
| Alternative Catalog Number: | ATA-HPA037532-100,ATA-HPA037532-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C2orf25, cblD, CL25022 |
| methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria |
| Anti-MMADHC |
| Clonality: | Polyclonal |
| Concentration: | 1.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 27249 |
| UniProt: | Q9H3L0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TLPDVLAEPLSSERHEFVMAQYVNEFQGNDAPVEQEINSAETYFESARVECAIQTCPELLRKDFESLFPEVANGKLMILTVTQKTKNDMTVWSEEV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MMADHC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in human cell line K562. |
|
|
HPA037532-100ul |
|
|
|
|
|
HPA037532-100ul |
|
|
HPA037532-100ul |
Product Guarantee and Expert Support
