Anti-RPP30

Artikelnummer: ATA-HPA037578
Artikelname: Anti-RPP30
Artikelnummer: ATA-HPA037578
Hersteller Artikelnummer: HPA037578
Alternativnummer: ATA-HPA037578-100,ATA-HPA037578-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TSG15
ribonuclease P/MRP 30kDa subunit
Anti-RPP30
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 10556
UniProt: P78346
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RPP30
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & microtubule ends.
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-RPP30 antibody. Corresponding RPP30 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA037578-100ul
HPA037578-100ul
HPA037578-100ul