Anti-RPP30
Catalog Number:
ATA-HPA037578
- Images (8)
| Article Name: | Anti-RPP30 |
| Biozol Catalog Number: | ATA-HPA037578 |
| Supplier Catalog Number: | HPA037578 |
| Alternative Catalog Number: | ATA-HPA037578-100,ATA-HPA037578-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TSG15 |
| ribonuclease P/MRP 30kDa subunit |
| Anti-RPP30 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10556 |
| UniProt: | P78346 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RPP30 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & microtubule ends. |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-RPP30 antibody. Corresponding RPP30 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA037578 |
|
|
|
|
|
HPA037578 |
|
|
HPA037578 |
Product Guarantee and Expert Support
