Anti-INPP4B
Artikelnummer:
ATA-HPA037682
- Bilder (7)
| Artikelname: | Anti-INPP4B |
| Artikelnummer: | ATA-HPA037682 |
| Hersteller Artikelnummer: | HPA037682 |
| Alternativnummer: | ATA-HPA037682-100,ATA-HPA037682-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | INPP4B |
| inositol polyphosphate-4-phosphatase, type II, 105kDa |
| Anti-INPP4B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8821 |
| UniProt: | O15327 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | INPP4B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to centrosome. |
|
|
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Western blot analysis in human cell lines MCF-7 and HEK293 using Anti-INPP4B antibody. Corresponding INPP4B RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA037682-100ul |
|
|
HPA037682-100ul |
|
|
HPA037682-100ul |
Produktgarantie und fachkundiger Support
