Anti-INPP4B

Catalog Number: ATA-HPA037682
Article Name: Anti-INPP4B
Biozol Catalog Number: ATA-HPA037682
Supplier Catalog Number: HPA037682
Alternative Catalog Number: ATA-HPA037682-100,ATA-HPA037682-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: INPP4B
inositol polyphosphate-4-phosphatase, type II, 105kDa
Anti-INPP4B
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 8821
UniProt: O15327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: INPP4B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Western blot analysis in human cell lines MCF-7 and HEK293 using Anti-INPP4B antibody. Corresponding INPP4B RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA037682-100ul
HPA037682-100ul
HPA037682-100ul