Anti-NSUN2
Artikelnummer:
ATA-HPA037896
- Bilder (8)
| Artikelname: | Anti-NSUN2 |
| Artikelnummer: | ATA-HPA037896 |
| Hersteller Artikelnummer: | HPA037896 |
| Alternativnummer: | ATA-HPA037896-100,ATA-HPA037896-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20303, Misu, MRT5, TRM4 |
| NOP2/Sun RNA methyltransferase family, member 2 |
| Anti-NSUN2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54888 |
| UniProt: | Q08J23 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCAFRLAQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NSUN2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human appendix and pancreas tissues using Anti-NSUN2 antibody. Corresponding NSUN2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human appendix shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NSUN2 antibody. Remaining relative intensity is presented. |
|
|
|
|
|
HPA037896-100ul |
|
|
HPA037896-100ul |
|
|
HPA037896-100ul |
Produktgarantie und fachkundiger Support
