Anti-NSUN2
Catalog Number:
ATA-HPA037896
- Images (8)
| Article Name: | Anti-NSUN2 |
| Biozol Catalog Number: | ATA-HPA037896 |
| Supplier Catalog Number: | HPA037896 |
| Alternative Catalog Number: | ATA-HPA037896-100,ATA-HPA037896-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ20303, Misu, MRT5, TRM4 |
| NOP2/Sun RNA methyltransferase family, member 2 |
| Anti-NSUN2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 54888 |
| UniProt: | Q08J23 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCAFRLAQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NSUN2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human appendix and pancreas tissues using Anti-NSUN2 antibody. Corresponding NSUN2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human appendix shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NSUN2 antibody. Remaining relative intensity is presented. |
|
|
|
|
|
HPA037896-100ul |
|
|
HPA037896-100ul |
|
|
HPA037896-100ul |
Product Guarantee and Expert Support
