Anti-TNKS1BP1

Artikelnummer: ATA-HPA037929
Artikelname: Anti-TNKS1BP1
Artikelnummer: ATA-HPA037929
Hersteller Artikelnummer: HPA037929
Alternativnummer: ATA-HPA037929-100,ATA-HPA037929-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ45975, KIAA1741, TAB182
tankyrase 1 binding protein 1, 182kDa
Anti-TNKS1BP1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 85456
UniProt: Q9C0C2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDLEVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEARE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TNKS1BP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-TNKS1BP1 antibody. Corresponding TNKS1BP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, prostate, skeletal muscle and skin using Anti-TNKS1BP1 antibody HPA037929 (A) shows similar protein distribution across tissues to independent antibody HPA037930 (B).
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human prostate using Anti-TNKS1BP1 antibody HPA037929.
Immunohistochemical staining of human kidney using Anti-TNKS1BP1 antibody HPA037929.
HPA037929-100ul
HPA037929-100ul
HPA037929-100ul