Anti-TNKS1BP1

Product Overview

• Article Name: Anti-TNKS1BP1
• Biozol Catalog Number: ATA-HPA037929
• Supplier Catalog Number: HPA037929
• Alternative Catalog Number: ATA-HPA037929-100,ATA-HPA037929-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ45975, KIAA1741, TAB182

Product Description

tankyrase 1 binding protein 1, 182kDa

Additional Information

Anti-TNKS1BP1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 85456
• UniProt: Q9C0C2
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDLEVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEARE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TNKS1BP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-TNKS1BP1 antibody. Corresponding TNKS1BP1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human kidney, prostate, skeletal muscle and skin using Anti-TNKS1BP1 antibody HPA037929 (A) shows similar protein distribution across tissues to independent antibody HPA037930 (B).

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Immunohistochemical staining of human skin shows high expression.

Immunohistochemical staining of human prostate using Anti-TNKS1BP1 antibody HPA037929.

Immunohistochemical staining of human kidney using Anti-TNKS1BP1 antibody HPA037929.

HPA037929-100ul

HPA037929-100ul

HPA037929-100ul