Anti-METTL14
Artikelnummer:
ATA-HPA038002
- Bilder (8)
| Artikelname: | Anti-METTL14 |
| Artikelnummer: | ATA-HPA038002 |
| Hersteller Artikelnummer: | HPA038002 |
| Alternativnummer: | ATA-HPA038002-100,ATA-HPA038002-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA1627 |
| methyltransferase like 14 |
| Anti-METTL14 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 57721 |
| UniProt: | Q9HCE5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | METTL14 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in glomeruli and cells in tubules. |
|
|
HPA038002-100ul |
|
|
|
|
|
HPA038002-100ul |
|
|
HPA038002-100ul |
Produktgarantie und fachkundiger Support
