Anti-METTL14

Catalog Number: ATA-HPA038002
Article Name: Anti-METTL14
Biozol Catalog Number: ATA-HPA038002
Supplier Catalog Number: HPA038002
Alternative Catalog Number: ATA-HPA038002-100,ATA-HPA038002-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1627
methyltransferase like 14
Anti-METTL14
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 57721
UniProt: Q9HCE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: METTL14
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in glomeruli and cells in tubules.
HPA038002-100ul
HPA038002-100ul
HPA038002-100ul