Anti-PRPF19
Artikelnummer:
ATA-HPA038051
- Bilder (7)
| Artikelname: | Anti-PRPF19 |
| Artikelnummer: | ATA-HPA038051 |
| Hersteller Artikelnummer: | HPA038051 |
| Alternativnummer: | ATA-HPA038051-100,ATA-HPA038051-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | hPSO4, NMP200, PRP19, PSO4, UBOX4 |
| pre-mRNA processing factor 19 |
| Anti-PRPF19 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 27339 |
| UniProt: | Q9UMS4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PRPF19 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human kidney shows strong nuclear positivity. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PRPF19 antibody. Remaining relative intensity is presented. |
|
|
Western blot analysis using Anti-PRPF19 antibody HPA038051 (A) shows similar pattern to independent antibody HPA059070 (B). |
|
|
HPA038051-100ul |
|
|
HPA038051-100ul |
|
|
HPA038051-100ul |
Produktgarantie und fachkundiger Support
