Anti-PRPF19
Catalog Number:
ATA-HPA038051
- Images (7)
| Article Name: | Anti-PRPF19 |
| Biozol Catalog Number: | ATA-HPA038051 |
| Supplier Catalog Number: | HPA038051 |
| Alternative Catalog Number: | ATA-HPA038051-100,ATA-HPA038051-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | hPSO4, NMP200, PRP19, PSO4, UBOX4 |
| pre-mRNA processing factor 19 |
| Anti-PRPF19 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 27339 |
| UniProt: | Q9UMS4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRPF19 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human kidney shows strong nuclear positivity. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PRPF19 antibody. Remaining relative intensity is presented. |
|
|
Western blot analysis using Anti-PRPF19 antibody HPA038051 (A) shows similar pattern to independent antibody HPA059070 (B). |
|
|
HPA038051-100ul |
|
|
HPA038051-100ul |
|
|
HPA038051-100ul |
Product Guarantee and Expert Support
