Anti-VGLL4

Produktübersicht

• Artikelname: Anti-VGLL4
• Artikelnummer: ATA-HPA038225
• Hersteller Artikelnummer: HPA038225
• Alternativnummer: ATA-HPA038225-100,ATA-HPA038225-25
• Hersteller: Atlas Antibodies
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ICC
• Spezies Reaktivität: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Konjugation: Unconjugated
• Alternative Synonym: KIAA0121

Produktbeschreibung

vestigial-like family member 4

Zusatzinformationen

Anti-VGLL4

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.05 mg/ml
• Isotyp: IgG
• NCBI: 9686
• UniProt: None
• Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Reinheit: Affinity purified using the PrEST antigen as affinity ligand
• Sequenz: PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLP
• Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target-Kategorie: VGLL4
• Antibody Type: Monoclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Bilder

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.

Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.

Immunohistochemical staining of human endometrium shows moderate to strong positivity in glandular cells.

Immunohistochemical staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemical staining of human fallopian tube shows moderate positivity in glandular cells.

Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VGLL4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Western blot analysis in control (vector only transfected HEK293T lysate) and VGLL4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415121).

HPA038225-100ul